Loading...
Statistics
Advertisement

katokao.ru.com
www.katokao.ru.com/

Katokao.ru.com

Advertisement
Conversion Technology Metas Server
Katokao.ru.com is hosted in United States / San Jose . Katokao.ru.com doesn't use HTTPS protocol. Number of used technologies: 3. First technologies: Html, Javascript, Php, Number of used javascripts: 2. First javascripts: Caf.js, Parking_caf_281_1409192.js, Number of used analytics tools: 0. Its server type is: Tengine/1.4.2.

Technologies in use by Katokao.ru.com

Technology

Number of occurences: 3
  • Html
  • Javascript
  • Php

Advertisement

Javascripts

Number of occurences: 2
  • caf.js
  • parking_caf_281_1409192.js

Advertise

Number of occurences: 1
  • Google Adsense

Server Type

  • Tengine/1.4.2

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Katokao.ru.com

Missing HTTPS protocol.

    Meta - Katokao.ru.com

    Number of occurences: 1
    • Name:
      Content: text/html; charset=utf-8

    Server / Hosting

    • IP: 205.164.14.88
    • Latitude: 37.34
    • Longitude: -121.89
    • Country: United States
    • City: San Jose

    Rname

    • ru-com-wildcard-null-mx.centralnic.net

    HTTP Header Response

    HTTP/1.1 301 Moved Permanently Server: Tengine/1.4.2 Date: Wed, 18 May 2016 23:23:11 GMT Content-Type: text/html Content-Length: 286 Location: http://baidu.com/ X-Cache: MISS from s_bd41 X-Cache-Lookup: MISS from s_bd41:80 Via: 1.1 s_bd41 (squid/3.5.19) Connection: keep-alive HTTP/1.1 200 OK Date: Wed, 18 May 2016 23:27:51 GMT Server: Apache Last-Modified: Tue, 12 Jan 2010 13:48:00 GMT ETag: "51-47cf7e6ee8400" Accept-Ranges: bytes Content-Length: 81 Cache-Control: max-age=86400 Expires: Thu, 19 May 2016 23:27:51 GMT Content-Type: text/html X-Cache: MISS from s_bd41 X-Cache-Lookup: MISS from s_bd41:80 Via: 1.1 s_bd41 (squid/3.5.19) Connection: keep-alive

    DNS

    host: katokao.ru.com
    1. class: IN
    2. ttl: 60
    3. type: A
    4. ip: 205.164.14.88
    host: katokao.ru.com
    1. class: IN
    2. ttl: 900
    3. type: MX
    4. pri: 0
    5. target: ru-com-wildcard-null-mx.centralnic.net
    host: katokao.ru.com
    1. class: IN
    2. ttl: 900
    3. type: TXT
    4. txt: v=spf1 -all
    5. entries: Array

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.atokao.ru.com, www.ktatokao.ru.com, www.tatokao.ru.com, www.katokao.ru.com, www.atokao.ru.com, www.kgatokao.ru.com, www.gatokao.ru.com, www.kbatokao.ru.com, www.batokao.ru.com, www.knatokao.ru.com, www.natokao.ru.com, www.khatokao.ru.com, www.hatokao.ru.com, www.kyatokao.ru.com, www.yatokao.ru.com, www.klatokao.ru.com, www.latokao.ru.com, www.koatokao.ru.com, www.oatokao.ru.com, www.kuatokao.ru.com, www.uatokao.ru.com, www.kiatokao.ru.com, www.iatokao.ru.com, www.kmatokao.ru.com, www.matokao.ru.com, www.ktokao.ru.com, www.kaotokao.ru.com, www.kotokao.ru.com, www.kaptokao.ru.com, www.kptokao.ru.com, www.ka9tokao.ru.com, www.k9tokao.ru.com, www.katokao.ru.com, www.ktokao.ru.com, www.kaitokao.ru.com, www.kitokao.ru.com, www.kautokao.ru.com, www.kutokao.ru.com, www.kaokao.ru.com, www.katqokao.ru.com, www.kaqokao.ru.com, www.kataokao.ru.com, www.kaaokao.ru.com, www.kat okao.ru.com, www.ka okao.ru.com, www.katwokao.ru.com, www.kawokao.ru.com, www.kateokao.ru.com, www.kaeokao.ru.com, www.katzokao.ru.com, www.kazokao.ru.com, www.katxokao.ru.com, www.kaxokao.ru.com, www.katcokao.ru.com, www.kacokao.ru.com, www.katkao.ru.com, www.katobkao.ru.com, www.katbkao.ru.com, www.katohkao.ru.com, www.kathkao.ru.com, www.katogkao.ru.com, www.katgkao.ru.com, www.katojkao.ru.com, www.katjkao.ru.com, www.katomkao.ru.com, www.katmkao.ru.com, www.kato kao.ru.com, www.kat kao.ru.com, www.katovkao.ru.com, www.katvkao.ru.com, www.katoao.ru.com, www.katoktao.ru.com, www.katotao.ru.com, www.katokao.ru.com, www.katoao.ru.com, www.katokgao.ru.com, www.katogao.ru.com, www.katokbao.ru.com, www.katobao.ru.com, www.katoknao.ru.com, www.katonao.ru.com, www.katokhao.ru.com, www.katohao.ru.com, www.katokyao.ru.com, www.katoyao.ru.com, www.katoklao.ru.com, www.katolao.ru.com, www.katokoao.ru.com, www.katooao.ru.com, www.katokuao.ru.com, www.katouao.ru.com, www.katokiao.ru.com, www.katoiao.ru.com, www.katokmao.ru.com, www.katomao.ru.com, www.katoko.ru.com, www.katokaoo.ru.com, www.katokoo.ru.com, www.katokapo.ru.com, www.katokpo.ru.com, www.katoka9o.ru.com, www.katok9o.ru.com, www.katokao.ru.com, www.katoko.ru.com, www.katokaio.ru.com, www.katokio.ru.com, www.katokauo.ru.com, www.katokuo.ru.com, www.katoka.ru.com, www.katokaob.ru.com, www.katokab.ru.com, www.katokaoh.ru.com, www.katokah.ru.com, www.katokaog.ru.com, www.katokag.ru.com, www.katokaoj.ru.com, www.katokaj.ru.com, www.katokaom.ru.com, www.katokam.ru.com, www.katokao .ru.com, www.katoka .ru.com, www.katokaov.ru.com, www.katokav.ru.com,

    Other websites we recently analyzed

    1. Jim Winter - State Farm Insurance Agent in St James, NY
      Contact Saint James State Farm Agent Jim Winter at (631) 584-5929 for life, home, car insurance and more. Get a free quote now
      Dallas (United States) - 45.33.12.50
      Server software:
      Technology: CSS, Html, Html5, Javascript
      Number of Javascript: 10
      Number of meta tags: 3
    2. Search results for: 'twist'
      Dallas (United States) - 173.192.123.190
      Server software: Microsoft-IIS/7.5
      Technology: CloudFront, AdRoll, DoubleClick.Net, CSS, Fancybox, Html, Javascript, jQuery, Facebook Retargeting, Google Analytics, Google AdWords Conversion Tracking, Google Remarketing, Hotjar, Magento, Facebook Box
      Number of Javascript: 30
      Number of meta tags: 3
    3. meetwebs.com
      Scottsdale (United States) - 50.63.202.46
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    4. Alexandra Minna Stern Professor. Historian. Public Scholar - Home
      Alexandra Minna Stern
      San Francisco (United States) - 199.34.228.100
      Server software: Apache
      Technology: CSS, Html, Html5, Iframe, Javascript, Php, SVG, Google Analytics, Quantcast Measurement, Webly
      Number of Javascript: 6
      Number of meta tags: 4
    5. CHEN WEI
      Tianjin (China) - 221.238.195.113
      Server software: Microsoft-IIS/7.0
      Technology: CSS, Html
      Number of meta tags: 2
    6. Henning80.de
      Germany - 31.47.241.100
      Server software: Apache
      Technology: CSS, Html, Javascript, jQuery UI, Php
      Number of Javascript: 4
      Number of meta tags: 1
    7. usvos.info
      United States - 208.91.197.27
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    8. pleasegivewillyapleasemaamsir.org
      Scottsdale (United States) - 50.63.202.54
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    9. Marlboro Florists - Flowers in Marlboro NY - Love's Flowers
      Order flowers online with Same Day Delivery from Love's Flowers. Fresh flowers and hand delivered right to your door. Experience the Teleflora difference!
      Oklahoma City (United States) - 65.198.163.112
      Server software:
      Technology: CSS, Html, Iframe, Javascript, jQuery Cycle, Php, Maxymiser, Facebook Like box
      Number of Javascript: 10
      Number of meta tags: 1
    10. conjuegamos.com
      Switzerland - 141.8.224.247
      Server software: nginx/1.9.9
      Technology: Html

    Check Other Websites